Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardensinsectswildflowerrealistic flowerswing
Bee from Simple animal
Irises from Iris
Hummingbird from Hummingbirds
Daisy from Plants coloring book
Ivy-leaf Morning Glory from Morning glory
Bindweed flower from Bindweed
Daisy from Daisy
Dianthus 2 from Carnation
Dianthus 1 from Carnation
Regal Sunbird from Sunbird
Head of Sunflower from Sunflower
Ruby Throated Hummingbird from Hummingbirds
Daisy from Daisy
Dog Rose Flowers from Wildflower
Hardy Amaryllis from Amaryllis
Bellflower from Bellflower
Wild Prairie Rose from Perennial
Butterfly Stands On A Plant from Flower and butterfly
Dandelion from Celebrating wildflowers coloring book
Ulysses or Blue Mountain Butterfly from Animals
Fan Columbine from Columbine
Dandelion from Plants iii coloring book
Oregon Grape Flowers from Evergreen trees
Buff Tailed Bumblebee from Animals
Cartoon Honey Bee from Simple animal
Zebra Swallowtail Butterfly from Animals
Realistic European Wasp from Animals
Bluebonnet Flower from Lupin
Hummingbird from Simple animals coloring book
Monarch Butterfly from Animals
Buckeye Butterfly on a Flower from Butterfly
Marigold from Marigolds
Bellflower from Bellflower
Bellflowers from Bellflower
Rocky Mountain Columbine from Columbine
Godetia Rubicunda 'Farewell to Spring' from Godetia
China Aster from Asters
Allen's Hummingbird from Hummingbirds
Papillon from Realistic dogs
Daffodil flower from Daffodil
Saucer Magnolia from Magnolia
Youth-and-Age Zinnia Flowers from Zinnia
Chrysanthemum from Realistic flowers
Bellflower from Bellflower
Insects from Animals
Violets from Violet
Daisy from Plants ii coloring book
Butterfly on Daisy from Flower and butterfly
Dandelion from Plants ii coloring book
Iris Blossom from Iris
Antirrhinum Majus or Common Snapdragon from Snapdragon
Bee from Animals
Bee from Animals
Ulysses Butterflies from Forest animal
Life Cycle of a Painted Lady Butterfly from Biology
Common Goldenrod from Goldenrod
Bee in the Forest from Animals
Gerbera from Gerberas
Durian Branch, Cross Section and Seed from Durian
Snapdragon Vine from Snapdragon
Butterfly from Nps
Butterfly from Animals
Butterfly from Animals
Butterfly from Animals
Bee from Animals
Orange Honeysuckle from Celebrating wildflowers coloring book
Ragged Robin or Deerhorn Clarkia from Celebrating wildflowers coloring book
Ladybug from Ladybug
Ladybug from Ladybug
Bumblebee from Bumblebee
Australian Damselfly from Damselfly
Giant Blue Morpho Butterfly from Animals
Elegant Zinnia from Zinnia
Cute Bees from Simple animal
Field Bellflower (Campanula Patula) from Bellflower
Daisies from Daisy
Larkspur from Larkspur
Summer Flowers from Summer
Ladybug from Simple animals coloring book
Cherries with Leaves from Cherry
Rose Vintage Botanical Flower from Roses
Blooming Hibiscus Flower from Hawaii flower
Bumblebee from Bumblebee
Lavender from Plants ii coloring book
Bee from Cartoon animals coloring book
Ladybug from Ladybug
Chrysanthemum Indiana from Realistic flowers
Daizy from Plants iii coloring book
Marigold from Marigolds
Anemone Transsilvanica from Anemone
Anemone from Anemone
Pollinators of Alaska from Nps
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Orchid Lycaste Aromatica from Orchid
Chrysanthemum 1 from Perennial
Iris Flower Blossom from Iris
Iris Motif from Iris
Black Elderberry from Elderberry
Disa Kewensis Orchid from Orchid
Double Delight Hybrid Tea Rose from Roses
101 - 200 of 1,830 Next page
/ 19